PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g021030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family M-type_MADS
Protein Properties Length: 365aa    MW: 41189.2 Da    PI: 4.693
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g021030.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.32e-131050242
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                       i+++ +r  t+  R++g+lKK + LS+LCd+++++ii+ +
  Sopen11g021030.1 10 LIKDDKKRMKTLVTRKAGLLKKISQLSILCDIKACMIIYDE 50
                      5999**********************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-12161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-17176IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.82152IPR002100Transcription factor, MADS-box
CDDcd002667.80E-17276No hitNo description
PfamPF003195.7E-121152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGRSKIQVEL IKDDKKRMKT LVTRKAGLLK KISQLSILCD IKACMIIYDE GNNNNCEMWP  60
NDSNELINLY KNQPFEGPTK RGKTLCEDEI KVEKDPDSRF DYFENDEKKK ADAIKVEKYP  120
TWDSRFDYLS QKELQNLVGV ISKRMENAKG RTELLNGSCS LSHQQQIWDY NNLMNQTTTL  180
SNNNLFQSNI PISSTVNSMG AGMDYQFCTA NYSMMNESEN WYGVGSSLTM MQHNMANNGI  240
GSSSTILHPM GDNYGIIDSS STMMLPMRNN EIGSSSTMQQ PMYQYPFMYN GSTHVIGSSS  300
TMQPPMGQYP FTNNDDSTGD IGSSSTIQPI GNNDEIGSTL TLMQPMDQYP FICNDSTYDL  360
SYGFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057633.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog
TrEMBLK4D7140.0K4D714_SOLLC; Uncharacterized protein
STRINGSolyc11g020620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.18e-14AGAMOUS-like 103